SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000020057 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000020057
Domain Number 1 Region: 47-322
Classification Level Classification E-value
Superfamily L domain-like 4.83e-50
Family Ngr ectodomain-like 0.0014
Further Details:      
 
Domain Number 2 Region: 388-458
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000356
Family Fibronectin type III 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000020057   Gene: ENSXMAG00000020010   Transcript: ENSXMAT00000020085
Sequence length 639
Comment pep:novel scaffold:Xipmac4.4.2:JH556714.1:589471:591528:-1 gene:ENSXMAG00000020010 transcript:ENSXMAT00000020085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTCPSVCRCDEDFIYCNDRGLSSIPSLPPSASVLYLQNNHINNPGLPTSLERHLSVRVVY
LYDNELDEFPMHLPPSVRELHLQDNNIRTIPRTTLARMPLLEKLHLDDNSISTVSIEDQA
FADNPRLRLLFLSRNHLSSIPSGLPASLEELRLDDNRISTIPTHAFRGLNSLRCLVLDGN
LLANQRIADDTFSRLSNLTELSLVRNSLQTPPINLPSAHLQRLSLQDNALTHMPRGSLDG
MHRLQRLDLSGNNLTTLPRGLFKDLDSLGQLLVRGNPWHCGCNLRWLYDWLRARGNTITV
RGLTCHGPDRVRDLALIDLGSEMEECEVVRLTGTKDKGAVGGVESSTTNAPPQGSLFTLR
SKRPGFGFPDSGLDYTLSSSGVGKSLALNVKPLSHNSIRVTWSAAQPSSSFRLSWLRQGT
GNAMESITETLVRGDRQEYLLSSLQPRSSYIICMVPLAVSSESKATVSGNADSDEALVCA
KAETSDPSTSEEEEDEDSHHITSLPLAGIIGGATATVSLALIFGIFCWYGHRTGHLCSRD
HYTRSSSRKSKTYDDYIESGTKKDNTILEIRGPGFQMTPMPACPPMQPKPLREDYIIHTI
FPSNGTGLYKGSNHVSNAGHGTNRGYREGGIPDIDYCYT
Download sequence
Identical sequences M4B012
ENSXMAP00000020057 ENSXMAP00000020057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]