SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000020168 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000020168
Domain Number 1 Region: 248-498
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.76e-60
Family Voltage-gated potassium channels 0.00056
Further Details:      
 
Domain Number 2 Region: 122-219
Classification Level Classification E-value
Superfamily POZ domain 5.76e-26
Family Tetramerization domain of potassium channels 0.00000592
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000020168   Gene: ENSXMAG00000020121   Transcript: ENSXMAT00000020196
Sequence length 578
Comment pep:novel scaffold:Xipmac4.4.2:JH557305.1:87970:89706:1 gene:ENSXMAG00000020121 transcript:ENSXMAT00000020196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIALVSFENGGAKGSGGGGGGGGGGNAEESCRNALEVPQPGFVQSGLGEEFGKELNTRG
SPQQQQQHHQQQQQRSPWKINDMNNTLSCSENAMDALLRADHSPHLFDEDMLDMDMDTES
NERVLINIAGLRYETQLGTLNQFPDTLLGDPAKRIKYFDPLRNEYFFDRNRPSFDGILYF
YQSGGKIRRPVNVSIDVFADEIRFYQLGEEAMERFREDEGFIKEEEKPLPQNEFQKQVWL
IFEYPESSSPARGIAIVSVIVITISIITFCLETLPEFRDERELAVSSRLDNSTAPRPSPT
FTDPFFIIETTCVIWFTFELIVRFFACPSKSEFSKTIMNIIDIMSIMPYFITVGTELAEQ
QGQEHQNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLF
IGVILFSSAVYFAEADEPESHFSSIPDAFWWAVVTMTTVGYGDMRPVTVGGKIVGSLCAI
AGVLTIALPVPVIVSNFNYFYHRETDQDQSSLKDEPSGGPESPEVKRKGSRTSVKSQDVE
KNESDGASVEKANIKANSSMDFKKSLYAFCLDTRETDL
Download sequence
Identical sequences M4B0C3
ENSXMAP00000020168 ENSXMAP00000020168 XP_005813893.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]