SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|111305834|gb|AAI21468| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|111305834|gb|AAI21468|
Domain Number 1 Region: 48-245
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.21e-39
Family Laminin G-like module 0.0013
Further Details:      
 
Domain Number 2 Region: 285-351
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000816
Family VWC domain 0.013
Further Details:      
 
Domain Number 3 Region: 497-601
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000534
Family Growth factor receptor domain 0.0088
Further Details:      
 
Domain Number 4 Region: 445-486
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000232
Family EGF-type module 0.013
Further Details:      
 
Domain Number 5 Region: 700-772
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000105
Family VWC domain 0.022
Further Details:      
 
Domain Number 6 Region: 606-648
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000173
Family EGF-type module 0.015
Further Details:      
 
Domain Number 7 Region: 352-409
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000952
Family VWC domain 0.034
Further Details:      
 
Weak hits

Sequence:  gi|111305834|gb|AAI21468|
Domain Number - Region: 410-444
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00621
Family EGF-like domain of nidogen-1 0.083
Further Details:      
 
Domain Number - Region: 780-820
Classification Level Classification E-value
Superfamily FnI-like domain 0.0209
Family VWC domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|111305834|gb|AAI21468|
Sequence length 828
Comment nell1 protein [Xenopus (Silurana) tropicalis]
Sequence
HFMFSGCRGIIGAPSPLTAPMDGMLAVWAWVLTARAVLGLGTDPDLQIDVITELELVNST
RGVTQVFGVHNGSKAFLFQDGAREIHAAPHMSEKVIQLFRNKSEFTFLASIQQRSSTSGV
ILSIREMEHSFFELESSGLRDEIRYHYRFNGKSRTEAFPYRLADGQWHKIALTVSASHVL
LHVDCNRIYERVIDPPDANLSPGSSLWLGQRNRKHGFFKGVIQDVKMIFMPNGYITQCPN
LNRTCPTCSDFLSLVQGIMDLQELLAKMTAKLNYAETRLSQLENCHCEKTCNVREVVYRD
RDSWVDDDHCRNCTCKNGAVECRRMLCPPLNCSSDSLPVHVAGQCCKVCRPKCIYGGKVL
AEGDRILTKSCRECKNGSLQKLMDPCPPLNCSEADRVLPENQCCSVCRGHNFCADGHRCG
ENSECRNHNNKATCECLSGFQPIQGDPAYCEDIDECAAKMHYCHANTVCVNLPGSYRCDC
VPGYIRVDDFSCTEHDECGEGESSCDENAICANSVRGHSCTCKPGYVGNGTVCRAFCEEG
CRYGGTCVAPNKCLCPSGFTGSHCEKDIDECAEGIIECHNHSRCVNLPGWFHCECRSGFH
DNGTYSISGESCVDIDECALRTHTCWNDSACVNLEGGFDCLCPSGPSCTGDCPHEGGLKR
NGQVWTLKEDRCSVCSCKDGKIFCRRTACDCQNPSVDLFCCPECDTRVTSQCLDQTGHKV
YHSGDNWTYSCQQCRCLEGEVDCWPLTCPILTCEYTTISEGECCPHCVDDPCIADGDPYD
IRKTCQDPQGITRLGGSVWTMVGSPCTTCKCKNGSVCCSVDLDCLHNN
Download sequence
Identical sequences Q0V9M7
gi|111305834|gb|AAI21468|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]