SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|111307891|gb|AAI21418| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|111307891|gb|AAI21418|
Domain Number 1 Region: 413-695
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.87e-87
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000012
Further Details:      
 
Domain Number 2 Region: 236-412
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 2.49e-53
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0000869
Further Details:      
 
Domain Number 3 Region: 697-802
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 3.93e-26
Family Anticodon-binding domain of Class II aaRS 0.0017
Further Details:      
 
Domain Number 4 Region: 174-234
Classification Level Classification E-value
Superfamily TGS-like 0.000000000000211
Family TGS domain 0.005
Further Details:      
 
Weak hits

Sequence:  gi|111307891|gb|AAI21418|
Domain Number - Region: 7-63
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0327
Family Mitotic arrest deficient-like 1, Mad1 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|111307891|gb|AAI21418|
Sequence length 814
Comment tarsl2 protein [Xenopus (Silurana) tropicalis]
Sequence
MAAHIAQRLTVQEQEIRRLNEEIGRLLELGLQGSVEHSPNPVLEQLRAENEKLKYRISHL
QRSLREEQERARPGQYGEPGLKDAAPVEEPKQQNNKAKEKGQATKGENSVGGKPSACEGN
KKNEKKAGKEVDGHKQEGPCAPGFIKDRLALYETLKNEHDALLAARAAHQSKPIKITLAD
GKQVDGESWKTTPYQVAIGISKGLADNVVIAKVNNELWDLDRPLEQDSNVELLKFDSEEA
QAVYWHSSAHILGETMENFYGGCLCYGPPIENGFYYDMYLDGRGVSSNEFPSLENMCKAI
IKEKQPFERLEVSKDLLLEMFKYNKFKCRILNEKVDTPTTTVYRCGPLIDLCRGPHVRHT
GKIKTLKIYKNSSTYWEGRADMETLQRIYGISFPDSKLMKEWEQFQEEAKNRDHRKIGRD
QELFFFHDLSPGSCFFLPRGAHIYNTLTDFIKGEYQIRNFTEVASPNIYNSKLWEMSGHW
QHYSENMFSFEVEKETFALKPMNCPGHCLMFGHRPRSWRELPLRFADFGVLHRNELSGTL
SGLTRVRRFQQDDAHIFCTMDQIQEEMNGCLQFLQSVYKVFGFTFQLHLSTRPENYLGEI
EIWNEAEKQLESSLNQFGEPWKLNPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPI
RFNLTYVSKDGDDKKRPVIIHRAILGSVERMIAILCENYGGKWPFWLSPRQVMVIPVGPS
CDEYAQQVCKDVFEAGFMAEVDLDHSCTLNKKIRNAQLAQCNFILVVGEKEKTDSAVNVR
TRDNKVHGEILLTSAIEKLKTLKKLRSKNAEEEF
Download sequence
Identical sequences Q0V9S0
ENSXETP00000043847 NP_001096223.1.99540 ENSXETP00000043847 gi|111307891|gb|AAI21418| gi|123909108|sp|Q0V9S0| gi|156717366|ref|NP_001096223|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]