SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|111308103|gb|AAI21459| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|111308103|gb|AAI21459|
Domain Number 1 Region: 173-245
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000648
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 2 Region: 235-295
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000688
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 3 Region: 46-108
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000432
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 4 Region: 112-171
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000389
Family Complement control module/SCR domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|111308103|gb|AAI21459|
Sequence length 477
Comment toll-like receptor 5 [Xenopus (Silurana) tropicalis]
Sequence
MCHGMCVRRARLFLGQRQSLLALLLWVQLSLCFGPVHLSVGFDDLTTCAVPEVPENGYRT
QSMGIFFENAVVRFHCKSGYKLKGPSKKMCVQLYNGSLAWKPSDTPVCLQEVTDCLAPYV
EDADILNKTYKTGDKLIMSCRDGFQTRYPDLDNMASICQDDGTWDNLAMCQGCLRPLVQP
HSYINISEFDFSFPVGRVVYYQCFPGYKLEGAEYIECMYNLIWSAEPPRCLDVEVCPLPP
MVTHGDYTCHPQPCDRYNHGTVIEFFCDPGYTLANDYKYFTCQSGEWFPSYPVMCIKTEA
SWPNTEDTLLTTWKIVAFTASTVLLVLLLVIIARSFQTKFKTHFLPRSPQDSTGEPDFVV
VDGVLVMLPSYDEAVSSAVNITPPGYTPSAGQRSPTPTDESHPPAYPGIPGNTDSLCEES
ETFDSLLDSSELAQTLHSASLSHVRAASAENATNGEAPSTSPSIDIADEIPLMDEEP
Download sequence
Identical sequences Q0V9N4
NP_001072359.1.99540 gi|111308103|gb|AAI21459| gi|118403548|ref|NP_001072359|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]