SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|112419256|gb|AAI21966| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|112419256|gb|AAI21966|
Domain Number 1 Region: 20-490
Classification Level Classification E-value
Superfamily Sema domain 4.32e-96
Family Sema domain 0.0014
Further Details:      
 
Domain Number 2 Region: 836-923
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000103
Family Other IPT/TIG domains 0.028
Further Details:      
 
Domain Number 3 Region: 932-1014
Classification Level Classification E-value
Superfamily E set domains 0.00000000000822
Family Other IPT/TIG domains 0.095
Further Details:      
 
Domain Number 4 Region: 493-536
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000011
Family Plexin repeat 0.0021
Further Details:      
 
Weak hits

Sequence:  gi|112419256|gb|AAI21966|
Domain Number - Region: 1018-1050
Classification Level Classification E-value
Superfamily E set domains 0.000168
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.087
Further Details:      
 
Domain Number - Region: 652-698
Classification Level Classification E-value
Superfamily Plexin repeat 0.0131
Family Plexin repeat 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|112419256|gb|AAI21966|
Sequence length 1060
Comment plxnd1 protein [Xenopus (Silurana) tropicalis]
Sequence
MAAAVLLLSLVALASGLELVSKFHSPQVTNNFALSAGEGLLYLAAVNRIYQLNWELRPEL
EDVTGPVPDSPLCHAPQLRETTCDFPRTSTPNYNKILLPDPEQGLLLTCGSIFQGLCELR
ALRNITLRAVPFPVDNAVPSMLNVAANHPNASTVGLLLRGPSGDTKLLVGATYTGYSSQF
FPWNQSIADHRFENSPEISIRALNLTASEKLFTFDISPSDDNIFKVKQSFKARHRLGFVR
AFQQGPFAYLAMNVEPAPAGKENRPSSVLARICLKSEPRTEPRKLTESYIQLGLRCEGPG
GVLYGRLLSVFAESENIFGIFEGKNEAALCMFPLRSVAQEIRGARRGCFESQDAGEVTVL
DSVVQGTGPSCERRNAKVKLQEEQLDCGAAHLQHPLAITRPLPAVPIYKEKGLTSVAVAN
VSGYMVVFLGNVSGHLIKINLDADMKIINKSMQYLEIASGQPVHHVMEFDPMDPTYLFVM
TSHQMTRVKVAECAKYRSCTECLAAADAYCGWCTLEGRCSLQKECQGSEDSAFWMSPNVG
QENMCPAMNSIPNKIDISSSTQRIILQITGKLPILYQMNVSCDYGNNIITPAVIDPDQDS
GQLLHCSFLPRDQFPSFPPNQDYVTVSMALSVGGNSIIQHKFIIYDCNRTQNMHPKNACT
SCVKSRWPCSWCVSQHRCVSSASQCDTIAQNSTESCPRITATSLTPTPTGVTKDYTLSLL
NTNITEGPKLECDFGTEQTFPAKWLNSSAVVCSNVLLYTSERTQSFPINLQLSDHKGLYL
DNPSMLSVEVYNCASQTPDCSSCLGRADLGHHCSWSESSMSCRLNSEILSISYPYTCPAP
DIRKIDPASGPLLGGTLVTIQGRNLGSRFSDINGRVKIGEIECTPIQEKYIVSEEIVCMT
GESPKLLTDWVSVDVNGGGRSKEKYSFQVPEVDYLSPDFGPWAGGTRVTISGTNLNIGRD
VRVLFNKTQECRDLVRTQSTIQCTVPPMKFLPETKVHICVQFEKKSCVKEELFFKYQENP
VIKSMDPRSSPLSGGRIITVTGERFDMVQSIMMGIEKKKK
Download sequence
Identical sequences Q0P4P1
gi|112419256|gb|AAI21966|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]