SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113205572|ref|NP_001037893| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113205572|ref|NP_001037893|
Domain Number 1 Region: 1-186
Classification Level Classification E-value
Superfamily EF-hand 4.02e-57
Family Calmodulin-like 0.0000000624
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113205572|ref|NP_001037893|
Sequence length 193
Comment hippocalcin-like protein 1 [Xenopus (Silurana) tropicalis]
Sequence
MGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLTVEEFKKIYANFFPYGD
ASKFAEHVFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRGE
MLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFKQMDTNNDGKLSLEEFIKGAKSDPSIV
RLLQCDPSSTSQF
Download sequence
Identical sequences A0A1L8G587 Q28IM6
8364.ENSXETP00000007606 NP_001037893.1.99540 XP_018121428.1.7800 gi|113205572|ref|NP_001037893| gi|123910270|sp|Q28IM6| gi|89268681|gb|CAJ82665| ENSXETP00000007606 ENSXETP00000007606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]