SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113205672|ref|NP_001037920| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113205672|ref|NP_001037920|
Domain Number 1 Region: 91-160
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.81e-18
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 2 Region: 29-101
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000162
Family Complement control module/SCR domain 0.00039
Further Details:      
 
Domain Number 3 Region: 151-214
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000688
Family Complement control module/SCR domain 0.00096
Further Details:      
 
Domain Number 4 Region: 334-390
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000208
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 5 Region: 203-267
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000391
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 6 Region: 269-343
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000017
Family Complement control module/SCR domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113205672|ref|NP_001037920|
Sequence length 419
Comment complement component 4 binding protein, alpha [Xenopus (Silurana) tropicalis]
Sequence
MISFSFCIRCWCIFLLIIIAALFSGTHGDCDFPPRLQDADLKTTQNSFTIGTVVEYVCRP
GYLKIPGRNTTITCLSNSTWSTPDVFCKLRSCGNPGDTLNGEFHAEDFNFGSVVNYTCNV
GYNMISKFNYRICQTDGTWSNAVPQCEAQICSPPENILNGSFNPTKDEYYYQDSVTYKCI
NNLVLVGKSSMFCTEFGNWSSAVPHCKGVNCANPDVPNSKRLSGFSGPYTLNSAITFKCN
DGFDIFGQSTIECNIDSQWEPSLPQCLGRCGSPPSLLYAELKPDFVDQKTFSSGAEVQYA
CLIGYNPISGKNSTIICHDATWSTPDVFCTSQICPPPENIVNGSFIPQKDQYLYKERVTY
QCFNNMEIVGDPSRFCTATGKWSSVVPSCNDGNTAGVILGNTVLMLTLIIVTQVLGKFF
Download sequence
Identical sequences Q28H28
NP_001037920.1.99540 gi|113205672|ref|NP_001037920| gi|89273853|gb|CAJ82127|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]