SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113205844|ref|NP_001037963| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113205844|ref|NP_001037963|
Domain Number 1 Region: 38-82
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000007
Family EGF-type module 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113205844|ref|NP_001037963|
Sequence length 139
Comment putative novel protein precursor [Xenopus (Silurana) tropicalis]
Sequence
MYGVLTFLLAGIPVCLSENFTAGMQNSSFVPESFTQSMFAECPDKYTSFCYHGTCRFLIS
QWEASCMCFNGYIGSRCQYVDLMKVMALDPRSFAVAAISVTLLVALSLIGSMCLGIYLCR
VKSEMSRISLLKNMESQDV
Download sequence
Identical sequences Q28H10
gi|113205844|ref|NP_001037963| gi|165971106|gb|AAI58294| gi|89273800|gb|CAJ81667| NP_001037963.1.99540 ENSXETP00000057443 ENSXETP00000057443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]