SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113205936|ref|NP_001037987| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113205936|ref|NP_001037987|
Domain Number 1 Region: 9-124
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.6e-42
Family GABARAP-like 0.000057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113205936|ref|NP_001037987|
Sequence length 124
Comment microtubule-associated protein 1 light chain 3 gamma [Xenopus (Silurana) tropicalis]
Sequence
MQSNQKNSQPFKQRKSLASRKEEVIGIKAKFPTKIPVIVERYRREKYLPLLDKTKFLVPK
DLSMMQFINIIRNRMNLSATQAFYLLVNNKSLASMSLTMAELYRDHKDEDGFLYMTYASQ
EMFG
Download sequence
Identical sequences Q28FC7
gi|113205936|ref|NP_001037987| gi|160773946|gb|AAI55038| gi|89269084|gb|CAJ81947| ENSXETP00000031856 NP_001037987.1.99540 8364.ENSXETP00000031856 ENSXETP00000031856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]