SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113931422|ref|NP_001039160| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113931422|ref|NP_001039160|
Domain Number 1 Region: 59-101
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000785
Family EGF-type module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113931422|ref|NP_001039160|
Sequence length 156
Comment epiregulin precursor [Xenopus (Silurana) tropicalis]
Sequence
MECFRNLYSLLVLVGVHLMYAVNGTTVVPLCQPSESSENCTTAMVQTTHSPKPVPMKIGK
CQMEMESFCWNGQCMYLVDLDEHYCRCEKGYTGIRCSHAELIYQPMNQEYLAITLFLSSL
LLLAVVVAAFFAYKWYKTKKAELPHNEYKEVSIQNL
Download sequence
Identical sequences Q28BU9
8364.ENSXETP00000013959 NP_001039160.1.99540 gi|113931422|ref|NP_001039160| gi|89272484|gb|CAJ83368| ENSXETP00000013959 ENSXETP00000013959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]