SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|114107997|gb|AAI22938| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|114107997|gb|AAI22938|
Domain Number 1 Region: 200-439
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.28e-73
Family Nuclear receptor ligand-binding domain 0.0000000027
Further Details:      
 
Domain Number 2 Region: 86-173
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.94e-29
Family Nuclear receptor 0.0000922
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|114107997|gb|AAI22938|
Sequence length 441
Comment nuclear receptor subfamily 1, group H, member 2 [Xenopus (Silurana) tropicalis]
Sequence
MSATAVDGSDVSLDEDSFHSVDTVLLDSASSAKLQIKEERSESQGSSSLPNENEVPGTDG
EGSSQSAAEEPERKRKKGPAPKMLGNEVCSVCGDKASGFHYNVLSCEGCKGFFRRSVIKN
AQYTCKNNGKCQMDMYMRRKCQECRLRKCREAGMREQCVLSEEQIRSKKIKKQQEDDVTR
PSSALVPPSPCMLSQEVVQLTPQQEKMIQQLVSAQQQCNKRSFSDQPKVTPWPLGSDPNS
REARQQRFAHFTELAIISVQEIVDFAKQIPGFLELSREDQIALLKASTIEIMLLETARRY
NHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRGMRQMQLDDAEYALLIAINIFS
ADRPNVQNHQLVENLQLPYVEALHSYTRIKRPQDHLMFPRMLMKLVSLRTLSSVHSEQVF
ALRLQDKKLPPLLSEIWDVHE
Download sequence
Identical sequences Q0IHW4
gi|114107997|gb|AAI22938| gi|118403952|ref|NP_001072853| ENSXETP00000000613 NP_001072853.1.99540 XP_012822217.1.99540 ENSXETP00000000613 8364.ENSXETP00000000613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]