SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|114108039|gb|AAI23084| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|114108039|gb|AAI23084|
Domain Number 1 Region: 263-319
Classification Level Classification E-value
Superfamily BPTI-like 7.95e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.003
Further Details:      
 
Domain Number 2 Region: 113-171
Classification Level Classification E-value
Superfamily BPTI-like 7.8e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0025
Further Details:      
 
Domain Number 3 Region: 191-248
Classification Level Classification E-value
Superfamily BPTI-like 3.69e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0044
Further Details:      
 
Weak hits

Sequence:  gi|114108039|gb|AAI23084|
Domain Number - Region: 47-94
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0628
Family Pan module (APPLE domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|114108039|gb|AAI23084|
Sequence length 394
Comment novel protein similar to spint2 (serine protease inhibitor, Kunitz type, 2 [Xenopus (Silurana) tropicalis]
Sequence
MAAWLGGLLLLIFPLALAQQPACDGYEVLDGFCLPEVGTPARQAMNELVSSGNASSEQEC
WELCCSTEHCDLAVMEEGSCKLIGCLYSGFNMCELESKEGTRSYRRKDIGPTPTLKDFCL
PEAVTGPCRAAFERWWYNPNTQTCENFTYGGCKGNLNNHIGEEVCMNKCAGVTAEMSNDI
LPPSKRMAEANSDPACTGKGVIGNCRASFPRWYFDAESQNCISFTYGGCGGTENNHKSVQ
ECADRCIVSKPEPAKVQAPMTGSFSEYCAAPSLTGPCRASFRRWYYDVTTATCVAFTYGG
CRGNKNNYLSVEDCVKNCAGRLDDDHTSDQTVLHRSITAVVLPALLAILAGILLLVMIVF
FVKMAKKNQRDAHFGAIWSPIDDKECLMNNAYTL
Download sequence
Identical sequences Q28D86
NP_001039077.1.99540 gi|113931260|ref|NP_001039077| gi|114108039|gb|AAI23084| gi|89273870|gb|CAJ82013| ENSXETP00000000309 ENSXETP00000000309 8364.ENSXETP00000000309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]