SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|115292136|gb|AAI22042| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|115292136|gb|AAI22042|
Domain Number 1 Region: 306-575
Classification Level Classification E-value
Superfamily Kelch motif 2.62e-67
Family Kelch motif 0.0000319
Further Details:      
 
Domain Number 2 Region: 27-142
Classification Level Classification E-value
Superfamily POZ domain 1.59e-33
Family BTB/POZ domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|115292136|gb|AAI22042|
Sequence length 589
Comment hypothetical protein MGC147232 [Xenopus (Silurana) tropicalis]
Sequence
MSVTVHENRKSRTSTGSMNISLYHKLSHSDCVLNHLNTMRKQRLFTDVTLWAGNRSFPCH
RAVLAACSQYFEAMFSNGLRESLDNTVNFHDSLHPEVLELLLDFAYSSKIIINEENAESL
LEAGDMLQFHDIRDAACEFLEKNLYPSNCLGMMILSDAHQCQRLYELSLRTCLSNFATLH
NTEDFCSLSKDMVLDLISSDELEIEDEQVVFNSVLHWVKEDLDKRKDYFPELLRKVRLAL
LPSELLKEAVVCEDLIIADERSKLIMDEAVVCKKKILQNDGVVTSLCAKPRKAGHTLLIL
GGQTFMCDKIYQVDHKAKEIIPKADLPSPRKEFSACAIGCKVYVTGGRGSENGVSKDVWV
YDTINEEWSKSAPMLIARFGHGSAELENCLYVVGGHTAVAGVFPASPSVSLKQVEKYDPL
TNKWTMMAPLRDGVSNAAVVSAKLKLFAFGGTSIHRDRVSKVQCYDPDENRWSIKAECPQ
PWRYTAAAVLGSQIFIMGGDTEFTAASAYRFDCETNQWTRIGDMTAKRMSCHALASGNKV
YVVGGYFGTQRCKTLDCYDPTSDSWNSITSVPYSLIPTAFVSTWKHLPA
Download sequence
Identical sequences Q0D2A9
ENSXETP00000016578 NP_001072541.1.99540 XP_012814705.1.99540 XP_012814706.1.99540 XP_012814709.1.99540 XP_017947662.1.99540 8364.ENSXETP00000016578 ENSXETP00000016578 gi|115292136|gb|AAI22042| gi|118405104|ref|NP_001072541| gi|123885212|sp|Q0D2A9|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]