SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|116487755|gb|AAI25706| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116487755|gb|AAI25706|
Domain Number 1 Region: 147-343
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.3e-57
Family Prokaryotic proteases 0.000000747
Further Details:      
 
Domain Number 2 Region: 358-455
Classification Level Classification E-value
Superfamily PDZ domain-like 4.6e-23
Family HtrA-like serine proteases 0.0048
Further Details:      
 
Domain Number 3 Region: 23-100
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000502
Family Growth factor receptor domain 0.0018
Further Details:      
 
Domain Number 4 Region: 87-132
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000022
Family Ovomucoid domain III-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116487755|gb|AAI25706|
Sequence length 458
Comment HtrA serine peptidase 1 [Xenopus (Silurana) tropicalis]
Sequence
MLWLAVLLTCGAPAALLPTSGVGCPSRCDPASCAPAPTNCPAGETALRCGCCPVCAAAEW
ERCGEGPEDPLCASGLRCVKNGGVARCQCPSNLPVCGSDGKTYPSLCRLQAESKAAQGKG
SAAIIPIQRGDCQQGQRDPDSPRYKYNFIADVVEKIAPAVVHIELFRMLPFFKREVPAAS
GSGFIVSEDGLILTNAHVVTNKHRLKVERSDGSTYDAQIIDVDEKADIALIKIKAKGKLP
VLLLGRSEDLRPGEFVVAIGSPFSLQNTVTTGIVSTAQRGGKELGLRNSDMDYIQTDAII
NYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKIRKFLAESHNRQSTGQGTKKKKYL
GIRMMSLSQGKLKELKEQVKDFPENTSGAYIVEVIPDTPAEEAGLKEGDIIISIGGKSVT
SSSDVSDAIKKEGTTLQLVIRRGNEDIPISVTPKEIEF
Download sequence
Identical sequences gi|116487755|gb|AAI25706|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]