SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|117558003|gb|AAI27376| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|117558003|gb|AAI27376|
Domain Number 1 Region: 65-131
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 1.66e-16
Family Ovomucoid domain III-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|117558003|gb|AAI27376|
Sequence length 174
Comment tmeff2 protein [Xenopus (Silurana) tropicalis]
Sequence
MARKAYRLHCTLWNRVSSVILPTLILIIAWPVKLAAFPTSLSDCQTPTGWNCSGFDDREN
DLFLCDTNTCKFDGECLRIGDSVTCDCQFKCPHDYIPVCGSNGVTFRNECYLRGAACKQQ
TEILVVSEGSCIADGGSGSGDGVNEGSGETVQKETSTCDICQFGAECDEDAEDV
Download sequence
Identical sequences A0JPD8
NP_001090692.1.99540 gi|117558003|gb|AAI27376| gi|148222818|ref|NP_001090692| ENSXETP00000059554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]