SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118403658|ref|NP_001072317| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118403658|ref|NP_001072317|
Domain Number 1 Region: 6-258
Classification Level Classification E-value
Superfamily Kelch motif 8.89e-59
Family Kelch motif 0.00011
Further Details:      
 
Domain Number 2 Region: 233-343
Classification Level Classification E-value
Superfamily Kelch motif 8.11e-20
Family Kelch motif 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|118403658|ref|NP_001072317|
Sequence length 350
Comment kelch domain containing 8A [Xenopus (Silurana) tropicalis]
Sequence
MEVPCAKDFYWQTLAPLQSPRVYCSLVETGGQIFAVGGCDDAGNPMNSFEVFSPEANRWS
SLEPMPSSRAGVAVVALGKRIMVVGGVGENQTPLKVVEVYNIDEGKWKKKSSLREPAMGI
SVTVRDCRVYAAGGMGSDLRPHCFLQQYDMLKDIWVHFAPMPTPRYGATSFLRGTKIYVL
GGRQAKYAVNAFEVFDIETRSWTKFPSIPNKRAYSRYVLSEGSLYSLGGLRQGGTYRRPK
FTKTVDIFDMEQGGWMKTERSCFLRKRRADFVAGSVHGRVVVAGGLGNQPSVLETAEIFH
PVKSRWESLSPMPTPRCACASIVLKNRLYAIGGVNQGPSSAVEMLSLVEP
Download sequence
Identical sequences Q0V9V6
ENSXETP00000002118 NP_001072317.1.99540 XP_017946826.1.99540 XP_017946827.1.99540 8364.ENSXETP00000002118 ENSXETP00000002118 gi|111307854|gb|AAI21379| gi|118403658|ref|NP_001072317|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]