SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118404594|ref|NP_001072756| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118404594|ref|NP_001072756|
Domain Number 1 Region: 117-151,180-405
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.8e-68
Family Nuclear receptor ligand-binding domain 0.0000000507
Further Details:      
 
Domain Number 2 Region: 67-144
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.86e-26
Family Nuclear receptor 0.0000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|118404594|ref|NP_001072756|
Sequence length 408
Comment estrogen-related receptor alpha [Xenopus (Silurana) tropicalis]
Sequence
MSSRDRRPDLCIKAEPGTPESIGRRSPSGSSDSSGHGPDPPGQRCCRDEEQDDVSGRGKY
VLNSIPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGNIEYSCPASNECEITKRRRK
ACQACRFTKCLRVGMLKEGVRLDRVRGGRQKYKRRPEGEILQYTSGGPAQQASATVVKKQ
TPVNAVVSHLLVAEPDKLFAMPDPALPDGYLKSMSTLCDLADREIVIIISWAKNIPGFSS
LSLSDQMSLLQSVWMEVLLLGVVFRSLPYEDEVVFAEDFVLDEESSRSARLTDLCSCILH
LVRKYRTLRVEKEEYVMLKALTLTNSDSVHIEDPDAVLRLRDALQEALSEYESGRHPEEP
CRDGKLLLTLPLLRQTAGRVLQHFHALREEGAVPMHKLFLEMLEAMMD
Download sequence
Identical sequences A0JM86
NP_001072756.1.99540 XP_012816862.1.99540 ENSXETP00000015699 gi|116487767|gb|AAI25781| gi|118404594|ref|NP_001072756| gi|169642644|gb|AAI60530| ENSXETP00000015699 8364.ENSXETP00000015699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]