SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|120537290|gb|AAI29009| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|120537290|gb|AAI29009|
Domain Number 1 Region: 31-62
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000069
Family CHHC finger 0.018
Further Details:      
 
Weak hits

Sequence:  gi|120537290|gb|AAI29009|
Domain Number - Region: 66-92
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000655
Family CHHC finger 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|120537290|gb|AAI29009|
Sequence length 183
Comment LOC100036720 protein [Xenopus (Silurana) tropicalis]
Sequence
KTKTNWKTLLPNPPRNVEVETRFYDPQDPERLLQCPYDSNHQIRACRFPYHLIKCRKNHN
DVAMHLATCPFNARHLVPRAELSHHISSCDDKSCIEQDIAGEKNYYQRDVSPCRWQTPPC
DEDWDKDLQNDKATFMWGIPSYPVPSSSGTNILMDPKNSLGSSLRAPKSLPYILPWKMHT
KRD
Download sequence
Identical sequences A1L1D6
gi|120537290|gb|AAI29009|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]