SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|121491458|gb|CAL50574| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|121491458|gb|CAL50574|
Domain Number 1 Region: 1-140
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 4.71e-47
Family Myeloperoxidase-like 0.0000216
Further Details:      
 
Domain Number 2 Region: 146-199
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000208
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Weak hits

Sequence:  gi|121491458|gb|CAL50574|
Domain Number - Region: 193-225
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00587
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|121491458|gb|CAL50574|
Sequence length 225
Comment thyroid peroxidase [Xenopus tropicalis]
Sequence
REFCGLSRLATPADLINAVSDQKLVAKMIALYSHPDNIDVWLGGLAEDFLPGARTGPLFA
CLIGKQMQALREGDRFWYENNNIFTKIQRSELEKHSLSRVICDNTGLSHVPLDAFLLGNY
PDNFVSCDSIPGINLEAWKESPEKGTTCGSPRKIENGDFAFCSEATVIYSCHSGYRLEGH
EEITCQGNEWSNQPPICSDINECEDQPNGPCHSSAKCKNTLGGFH
Download sequence
Identical sequences A1KCQ3
gi|121491458|gb|CAL50574|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]