SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|124481782|gb|AAI33057| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124481782|gb|AAI33057|
Domain Number 1 Region: 35-502
Classification Level Classification E-value
Superfamily Sema domain 3.01e-133
Family Sema domain 0.0000144
Further Details:      
 
Domain Number 2 Region: 1345-1471,1685-1874
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.51e-51
Family p120GAP domain-like 0.026
Further Details:      
 
Domain Number 3 Region: 1034-1138
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000478
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.037
Further Details:      
 
Domain Number 4 Region: 850-948
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000292
Family Other IPT/TIG domains 0.015
Further Details:      
 
Domain Number 5 Region: 947-1036
Classification Level Classification E-value
Superfamily E set domains 0.00000000000014
Family Other IPT/TIG domains 0.021
Further Details:      
 
Domain Number 6 Region: 505-557
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000772
Family Plexin repeat 0.0018
Further Details:      
 
Domain Number 7 Region: 1154-1226
Classification Level Classification E-value
Superfamily E set domains 0.0000011
Family E-set domains of sugar-utilizing enzymes 0.046
Further Details:      
 
Domain Number 8 Region: 804-838
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000183
Family Plexin repeat 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|124481782|gb|AAI33057|
Sequence length 1904
Comment LOC100037845 protein [Xenopus (Silurana) tropicalis]
Sequence
MLLHAEKPLPFHLWTFLVLLGSWIAAGDGTPKSFRTFTGTDWSLTHLVVHNKTGEVYLGA
INRIYKLSNNLTLMRTHVTGPVEDNEKCYPPPSVQSCPHGLVSTNNVNKLLLIDYSENRL
IACGSASQGICQFLRLDDLFKLGEPHHRKEHYLSSVNESGTMSGVIIEVPNGQNKLFVGT
PIDGKSEYFPTLSSRKLMGNEENAEMFGFVYQDEFVSSQLKIPSDTLSKFPTFDIYYVYS
FSSEQFVYYLTLQLDTQLTSPDSTGEQFFTSKIVRLCVDDPKFYSYVEFPIGCIKDGVEY
RLIQDAYLSKPGKRLAKELGISEREDILFTVFSQGQKNRIKPPKESVMCLFTLKKIKDKI
KERIQSCYRGDGKLSLPWLLNKELGCINSPLQIDDNFCGQDFNQPLGGTVTIEGTPLFLD
KEDGMTSVAAYDYRGHTVVFAGTRSGRMKKILVDLSASSHMAQQYENVVVHEGNAILRDL
VLSPDRQYIYAMTEKQVTRVPVESCEQYETCDACLGSRDPHCGWCVLHNMCSRKDKCERA
DELHRFTSDQRQCVQLTVHPRNISVTVSEVPMVLQAWNVPDLSAGVNCSFEDFTEMEGRI
LDGKIYCTSPSTKDVIPITRGHGDKRVLKLYLKSKETGKKFASVDFVFYNCSVHQSCLSC
VNGSFPCHWCKYRHVCTHNAADCSFQEGRVNMSEDCPQILPSTQIYIPVGVVKPITLTAK
NLPQPQSGQRNYECIFHIPGSVTRVTALRFNSTSIQCQNTSYNYEGNDISDLPVNLSVVW
NGHFVIDNPQNIQAHLYKCSALRESCGLCLKSDRRFECGWCVSEKKCTLRQNCPAYENPW
MHASTVNSRCTDPKITKLFPETGPKQGGTLLTITGENLGLRFEDIRFGVRVGHVMCVPIE
NEYISAEQIVCEIKDAGKMRVHEAQVEVCVKDCSQDYRAISPKSFTFVVPSFNRVTPSRG
PLSGGTWISIEGSYLNSGSDVSVDIGGRPCMFSWRTAKEIRCKTPQGPSTGKAEIQIHIN
RATLYNSEVHYNYTEDPTVQKIEPEWSIASGGTPLIVTGLNLATIKEPKIRAKYGDAERE
NNCTVYNDTTMVCLAPSVENPLRSPPENGDRPDEIGFIMDNVLALLIVNTTSFLYYPDPV
FEPLTASGNLELKPSSPLIIKGRNLIPAAPGNFRLNYTVLIGDTPCALTVSETQLLCESP
NLTGQHKVTIKAGGFEYSPGTLQIYSDSLLTLPAIIGIGGGGGLLLLIIIIVLIAYKRKS
RDADRTLKRLQLQMDNLESRVALECKEAFAELQTDIHELTNDLDGAGIPFLDYRTYAMRV
LFPGIEDHPVLKEMEVQANVEKSLTLFGQLLTKKHFLLTFIRTLEAQRSFSMRDRGNVAS
LIMTALQGEMEYATGVLKQLLSDLIEKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLYK
FLKECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLNPCADDVG
LSDESCCRSPQTLNCVNPENENAPEIPVKVLNCDTITQVKEKLLDAVYKGVPYSQRPKAG
DMDLEWRQGRMARIILQDEDVTTKIDNDWKRLNTLAHYQVTDGSSVALVPKQNSAYNISN
SSTFTKSLSRYESMLRTASSPDSLRSRTPMITPDLESGTKLWHLVKNHDHLDQREGDRGS
KMVSEIYLTRLLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHQIT
DYDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHKLG
KDSPSNKLLYAKDIPNYKSWVERYYADIAKMSVISDQDMSAYLAEQSRLHLSQFNSMSAL
HEIYSYITKYRDEILTALEKDEQARRQRLRSKLEQVIDTMAQSS
Download sequence
Identical sequences A2RUV3
NP_001090760.1.99540 gi|124481782|gb|AAI33057| gi|148237810|ref|NP_001090760|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]