SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|134023807|gb|AAI35574| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|134023807|gb|AAI35574|
Domain Number - Region: 155-221
Classification Level Classification E-value
Superfamily PH domain-like 0.00289
Family TFIIH domain 0.029
Further Details:      
 
Domain Number - Region: 22-82
Classification Level Classification E-value
Superfamily PH domain-like 0.0151
Family VPS36 N-terminal domain-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|134023807|gb|AAI35574|
Sequence length 342
Comment Bardet-Biedl syndrome 5 [Xenopus (Silurana) tropicalis]
Sequence
MLSVLDALWEDRDVRFDISPQQMKMRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRVIW
HSLALPRVNLAVGYNCIINITTRTANSKLRGQTEALYILTKCNNTRFEFIFTNLVPGSPR
LFTSVIAVHRAYETSKMYRDLKLRGALIQNKQLRLLPREQVYDKINGVWNLSSDQGNLGT
FFITNVRIVWHANMNDSFNVSIPYLQIRSIKIRDSKFGLALVIESSQQSGGYVLGFKIDP
VEKLQDSVKEINSLHRVYSASPIFGVEYEMEEKPQALEELTIEQVQDDVEIEADEHTDAF
VAYFADGNKQQDREPVYSEELGLAIEKLKDGFTLQGLWDVMG
Download sequence
Identical sequences A4IHK9
gi|134023807|gb|AAI35574| gi|62858999|ref|NP_001016238| NP_001016238.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]