SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|134023839|gb|AAI35577| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134023839|gb|AAI35577|
Domain Number 1 Region: 569-703,780-950
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.22e-78
Family Protein kinases, catalytic subunit 0.0000000147
Further Details:      
 
Domain Number 2 Region: 219-257,286-293,340-414
Classification Level Classification E-value
Superfamily Immunoglobulin 2.4e-18
Family I set domains 0.046
Further Details:      
 
Domain Number 3 Region: 29-107
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000385
Family I set domains 0.073
Further Details:      
 
Weak hits

Sequence:  gi|134023839|gb|AAI35577|
Domain Number - Region: 118-201
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00463
Family I set domains 0.021
Further Details:      
 
Domain Number - Region: 430-519
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0757
Family I set domains 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|134023839|gb|AAI35577|
Sequence length 1091
Comment LOC100124862 protein [Xenopus (Silurana) tropicalis]
Sequence
MMPTTRASLVLGCLLIIGPWVILAQNPLPSIFPEKDELVQRLHSSFSLTCTGESELSWQH
PHSESELGNVVIGSEENNSGLFVSVLEVTNASASNTGLYTCYYNHTQTEDSEIEGTDIYI
YVPDTNVPFVPPGLFDHIIVVEEDESAFIPCRTTDPSSQVTLKSIENSKTVSAFYDSKQG
FVGNFQPGSYICETVSNKMVYQTDLYILQTWKATHNISVEMEAPQTVFRTGETITISCIV
LENEVVELKWYYPGQQRGVGKRNVEESRVPSQRLVYTLTIANATADDSGEYQCAVLHATL
DNKVIKKTNITVHEKGFINLEPMFGSEEYANLHEVKSFIVDLHAYPCPRVFWLKDNRTLS
ENLTEITTSTVTTKETRFQSKLKLIRAKEEDSGLYTLVAQNDAETKSYSFILQIKVPALI
LELVDEHHGTSGEQTVGCLAKGMPVPDVEWLVCKDIKRCNNDTLWSLLAINGSEISMETH
QDYENTIESQVTFKKVEETMAIRCIARNDLGVVARELKLVAPTLRSELTVAAAVLVLLVI
VIISLIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFQRDGLVLGR
ILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGAHLNI
VNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFQSRHPEKSKKDLDIFGLNPADEST
RSYVILSFENNGDYMDMKQADTMQYVPMLEMKEPSKYSDIQRSLYDRPASYKKKPLSEVK
NILSDDGFDGFDGLTVLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAHGKIVKICD
FGLARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSFGILLWEIFSLGGTPY
PGMIVDSTFYNKIKSGYRMAKPDHATHEVYDIMVKCWNSEPEKRPSFRHLSDIVESLLPM
EYKRCYETVLHDFLKSDHPAVTRMRSDSDNSYIGVTYKNENKMKDRESGFDEQRLSADSG
YIIPLPDIDPVSEDESSKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIEMMDDIGI
DSSDLVEDSFL
Download sequence
Identical sequences A4IHL2
gi|134023839|gb|AAI35577| gi|156717500|ref|NP_001096290| NP_001096290.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]