SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|134024107|gb|AAI35633| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134024107|gb|AAI35633|
Domain Number 1 Region: 13-110,160-407
Classification Level Classification E-value
Superfamily MFS general substrate transporter 3.92e-31
Family LacY-like proton/sugar symporter 0.061
Further Details:      
 
Domain Number 2 Region: 435-487
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000112
Family Ovomucoid domain III-like 0.01
Further Details:      
 
Weak hits

Sequence:  gi|134024107|gb|AAI35633|
Domain Number - Region: 514-584
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00126
Family Glycerol-3-phosphate transporter 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|134024107|gb|AAI35633|
Sequence length 656
Comment LOC100124879 protein [Xenopus (Silurana) tropicalis]
Sequence
MGQAATNGSDKKPRGISKLKVFIFALSFAYVAKTLALAYSNSVITQIERRFSIPSSTAGF
IEGSFDIGNVLLIAFVSYFGAKLHRPKVIALGCLIMSLGSCLEALPHFLMPRYEYGSAVS
SPNQTASGAPLCLANQSLSSSAEPQGECRGGSMSLMWIFVLVGNLLRGIGETPVEPLGLS
YIDEFSQTENSPFYIGIIQTLSIAGPLLGYLLAALCTKLYVDIGSINLDEVTVTQRDIRW
VGAWWVGFLVSGAACLLAALPFWCLPRSLPKEGAENGSEPSETVALATPEPQGPNTPTKP
ALGLREFLRMIRGLFRNKIYVLFMIVTVLQFNAFSGYIAFLPKFVEQQYGKSSSEAIFLI
GVYNLPIISLGYFLGGYYMKRFKVSTYRAAQIGFYSEILTYLINYSAFFMGCENSLVAGV
TVSYGGTGDISYSQNFTSGCNAPCGCPGDVWDPVCGENGLAYISACHAGCATSVGEGQNT
IFHNCSCVWASPFPTNGSAALGQCPREEMCDTMLVAFMVMSFVCCLIFSFGAMPAYMVLI
RSLKPEEKSLGLGLHLLTARILGGIPSVVSFGALADSTCLKWGVLGCGERGACRMYDTDL
FRYLFHGIENIIRTSSYIPCVLILLILKREQAPQDSAPPTERVGGTRDDSVTNTEI
Download sequence
Identical sequences A4IHQ4
gi|134024107|gb|AAI35633| gi|156717524|ref|NP_001096302|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]