SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|134024142|gb|AAI36022| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134024142|gb|AAI36022|
Domain Number 1 Region: 320-479
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.76e-57
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000272
Further Details:      
 
Domain Number 2 Region: 158-318
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.91e-54
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000315
Further Details:      
 
Domain Number 3 Region: 121-160
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000001
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 4 Region: 77-125
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000128
Family EGF-type module 0.015
Further Details:      
 
Domain Number 5 Region: 25-64
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000775
Family EGF-type module 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|134024142|gb|AAI36022|
Sequence length 482
Comment edil3 protein [Xenopus (Silurana) tropicalis]
Sequence
MILKGVTQLLFFTSCWLSLIIAKGDVCDPNPCENGGICLSGLSDESFSCECPAGFSDLNC
SSVVEVDAEVVENSTTVGPCHPNPCHNGGICEISEAYRGDTFIGYVCKCTHGFNGIHCQH
NVNECEAEPCKNGGICTDLVANYSCECPGEYMGRNCQYRCSGPLGMEGGIISNQQITASS
THRALFGLQKWYPYFARLNKKGLVNAWTSAENDRWPWIQINLQKKMRVTGVITQGAKRIG
SPEYIKSYKIAYSNDGKSWSTYKVKRTSEDMVFRGNVDNNTPYANSFTPPIEAQYIRLYP
QVCRRHCTLRMELLGCELSGCSEPLGMKSGHIQDHQVTASSVFRTLNMDMFSWEPRKARL
DRQGKVNAWTSGKSDQSQWLQVDLLRPTKVTGIITQGAKDFGHVQFVGSYKVAYSNNGEH
WAVYQDGKQRKDKVFQGNFDNDTHRKNVMDPAIYARYIRILPWSWYGRITLRAELLGCTE
ED
Download sequence
Identical sequences A4IIH8
ENSXETP00000042835 ENSXETP00000042835 NP_001093683.1.99540 gi|134024142|gb|AAI36022| gi|154147732|ref|NP_001093683|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]