SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|134024230|gb|AAI36109| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134024230|gb|AAI36109|
Domain Number 1 Region: 29-118,167-282,309-426,520-579,607-631
Classification Level Classification E-value
Superfamily MFS general substrate transporter 6.15e-37
Family Glycerol-3-phosphate transporter 0.091
Further Details:      
 
Domain Number 2 Region: 442-487
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000596
Family Ovomucoid domain III-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|134024230|gb|AAI36109|
Sequence length 655
Comment LOC100125037 protein [Xenopus (Silurana) tropicalis]
Sequence
MTATSAENKSEGLHQKSTRCCHPFNNIKVFVLCHGFLQLSQLLLSGYLRSSISTIEKRFG
ISSQTSGILSSFNEIGNTVLIVFVSYFGSRVHRPRFIGCGAIIVCAAGFLMSLPHFIMGP
YEYDKSVASLLSNVTDICQPNGPIKSSDNDQCVEGVQKANKNVLFILFLGQILLGIGSVP
IQPFGISYIDDFASKRNSPLYIGILFAVTVMGPGVAFILGSAMLRFYVDIDKLSADEITL
TPKDPRWIGAWWLGYLVAGSVVAIASIPYFIFPREMPKQGPSEKPEEPKPSLMDEIKSKT
EENEKLTLSQFIKVFPKVLFRTVKNPVFILIVLAQGNMSAMVCGLATFMAKFLERQFSIT
ASLANLLIGSANIPAAMSGIVLGGIIMKRHRLTPKQSALMCVIGLIICIFTAIPLVFLGC
STQQFASPRMDHQGSSGIWQNVSECSGGCQCSSAAFNPVCGTDGVEYISPCYAGCGAVQF
GESPTEVLNYTRCTCIPAAGSAKPGSCGTVCGQLLVPFMVLSCLAGGLASMAQTPSFMLI
LRSVKPTDKSLAIGIQFMLLRILAWLPGPVMYGSVIDSTCILWGQKCGKKTSCQYYDNNL
LRQRFIGLQILFEIGGLIFFTAVFFVLRRREKVSAEKSMRENPETHALTQEGAKY
Download sequence
Identical sequences A4IIQ0
NP_001096429.1.99540 gi|134024230|gb|AAI36109| gi|156717778|ref|NP_001096429|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]