SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|134024290|gb|AAI36152| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134024290|gb|AAI36152|
Domain Number 1 Region: 152-434
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.46e-76
Family Nuclear receptor ligand-binding domain 0.00000000211
Further Details:      
 
Domain Number 2 Region: 102-179
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.33e-25
Family Nuclear receptor 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|134024290|gb|AAI36152|
Sequence length 435
Comment esrrg protein [Xenopus (Silurana) tropicalis]
Sequence
MSSKDRHIDSSCSSYIKTEPSSPASLTDSINHHSPGGSSDASGSYSSTMNGHQNGLDSPP
LYPSATGLGGNGPVRKRYDDCSSTIAEESQTKCEYMLNAMPKRLCLVCGDIASGYHYGVA
SCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRV
RGGRQKYKRRIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDIK
ALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGIVNRSLSFEDE
LVYAEDYIMDEDQSKLAGLLELNNAILQLVKKYKTMKLEKEEFVTLKAIALANSDSMHIE
DIEAVQKLQDVLHEALQDYEAGQHIEDPRRAGKLLMTLPLLRQTSTKAVQHFYNIKLEGK
VPMHKLFLEMLEAKV
Download sequence
Identical sequences A4IIT9
ENSXETP00000045243 NP_001093680.1.99540 XP_012818034.1.99540 8364.ENSXETP00000045241 gi|134024290|gb|AAI36152| gi|154147724|ref|NP_001093680|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]