SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|134024304|gb|AAI36171| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134024304|gb|AAI36171|
Domain Number 1 Region: 61-103
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000774
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 2 Region: 31-67
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000629
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  gi|134024304|gb|AAI36171|
Domain Number - Region: 105-138
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0471
Family Mitotic arrest deficient-like 1, Mad1 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|134024304|gb|AAI36171|
Sequence length 207
Comment EGF-like-domain, multiple 8 [Xenopus (Silurana) tropicalis]
Sequence
MKKELLRVKSVCCPGWKKKEPTSEDCEEALCHKPCQNGGTCVKPNMCRCPAGWGGRYCHV
DIDECRRPSKPCPQLCINTRGSYRCECQPGFTLGEDGKSCTENKAPSQLPAQQAEDASHR
LSNEIQELRNLVETLEQRLDSTLSAVQRLFPVKLSEIHSDQVHEFWERIQSLDRMDSFSD
QLMYMEEKMGECSCRSNEIEMAVNLKR
Download sequence
Identical sequences Q0VFR0
gi|110645722|gb|AAI18736| gi|118404042|ref|NP_001072194| gi|134024304|gb|AAI36171| NP_001072194.1.99540 ENSXETP00000011396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]