SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|134024392|gb|AAI35842| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134024392|gb|AAI35842|
Domain Number 1 Region: 201-321
Classification Level Classification E-value
Superfamily EF-hand 4.9e-34
Family Osteonectin 0.0064
Further Details:      
 
Domain Number 2 Region: 316-381
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.48e-18
Family Thyroglobulin type-1 domain 0.00082
Further Details:      
 
Domain Number 3 Region: 132-184
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000119
Family Ovomucoid domain III-like 0.0088
Further Details:      
 
Weak hits

Sequence:  gi|134024392|gb|AAI35842|
Domain Number - Region: 395-430
Classification Level Classification E-value
Superfamily ARM repeat 0.0604
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|134024392|gb|AAI35842|
Sequence length 433
Comment spock3 protein [Xenopus (Silurana) tropicalis]
Sequence
MMKVALVFVCAAACSQVLAAAAAAAAAATGRSDRGNFLDDKQWLTTVSQYDKDAAGHWNR
FRDEVEDDYFRTWNPGRPFDQALDPSKDPCLKVKCSRHKVCIAQDQETAVCISHRRITHS
MKEAGLSYKYWRGVPLSSSCKQCPIINTNPVCGSDGHTYSSQCKLEYQACLSGKQISVKC
EGHCPCSPNKLKTASKTNKRVCTDREFREIANRLRDWFKALHESGFQNKKSKTVTRAERS
RFDTSILPICRDSLGWMFNRLDTNYDLLLDQSELGSIYIDKNEQCTKAFFNTCDTYKDSL
ISNNEWCYCFQRQQDPPCQTELGNIQKQQGGKKLLGYYIPVCDEDGYYKPTQCHGSVGQC
WCVDRYGNEVSGSRKIGSAECGSDSETSGDFGSGDFHDWTDEEDDEDEMMNDEDEIEDDD
EDEGDDEDEDGYI
Download sequence
Identical sequences A4II43
gi|134024392|gb|AAI35842| gi|156717308|ref|NP_001096196| NP_001096196.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]