SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|134024435|gb|AAI35430| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134024435|gb|AAI35430|
Domain Number 1 Region: 297-568
Classification Level Classification E-value
Superfamily Kelch motif 2.09e-51
Family Kelch motif 0.00028
Further Details:      
 
Domain Number 2 Region: 10-128
Classification Level Classification E-value
Superfamily POZ domain 1.92e-34
Family BTB/POZ domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|134024435|gb|AAI35430|
Sequence length 590
Comment LOC100124817 protein [Xenopus (Silurana) tropicalis]
Sequence
MVRNIDDLEFCLPSHSDAILSGLQALRFNSRLSDVVLVVQGREFPCHRAVLALCSQYFHA
MFTGDFQESIAAQVEIKEVDPEVMETLIDFSYTGRLTINQSNVESLIRTSNLLSFPAVRK
VCSRYLQQQMDATNCLGIWEFGETHGCPEVAAKALSFLQENFEAVSQEEEFLLLSPERLL
CYLGDPLLQVRDEESRTKAALHWVKQDEEGRAHCLPQLLNVARLSSLTDQYLQELMEAEP
LISESEVCKTLISKSLGQETRGPREQSLVYLEEVLVVVGGKVLEEEEDEDEDEEDEETPR
TSANFAYYNTKTKKWMSVPDFPDYNKWGFSVTSLNNDVYVTGGSRGSRDDSWSTRQGWRF
VLNEGIWKPITPMINPRTNHASASLNGEIYVIGGTLQEAVEVECYDPYSGTWSLISPAQK
YVSNFAAVGCSGKLYLIGSCAMKYNALTLQCYNPATDGWSVIASPFIPKYLSSPRCCTVG
GAVYLVADNTKKVYMYLPEVNLWKKVQLLHTLHENGGMTAVGSRLYVTGGHWHGMAREYS
VVMESYDCSADVWKREGPLPSRWLYHCTSTIFMDTSRWTEKFQGQSEAEH
Download sequence
Identical sequences A4IH96
8364.ENSXETP00000026461 NP_001096255.1.99540 XP_012825408.1.99540 ENSXETP00000026461 gi|134024435|gb|AAI35430| gi|156717430|ref|NP_001096255| ENSXETP00000026461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]