SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|134025825|gb|AAI36225| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134025825|gb|AAI36225|
Domain Number 1 Region: 217-503
Classification Level Classification E-value
Superfamily Kelch motif 7.85e-64
Family Kelch motif 0.0000817
Further Details:      
 
Domain Number 2 Region: 23-136
Classification Level Classification E-value
Superfamily POZ domain 8.89e-33
Family BTB/POZ domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|134025825|gb|AAI36225|
Sequence length 548
Comment klhl32 protein [Xenopus (Silurana) tropicalis]
Sequence
MPSEICLSVQEMLTGQRHCQSISHKDAVLSALNQQRNDGILCDITLVAEEQKFHAHKAVL
AACSDYFRAMFSLCMVESEADEVNLHGVTSLGLKQALDFAYTGQILLEPGAIQDVLAAGS
HLQLLELLNLCSQYLIQLAVRWLEHNCRYQYMDELLQYVRFGLMDTNTLHTVALSHPLIQ
SSETATALINEALEYHQSIYAQPVWQTIRTEPRFQSNTLYIVGGKKREICKVRELRYFNP
IDQENVHIAGIANWSELTPMPVGRSHHCVAIMGNFLFAAGGEVEHASGRTCAVRTACRYD
PRSNSWIEIAPMKNCREHFVLGAVGDLLYAVGGRNELRQVLPSVERYCPKKNKWTFAQSF
DRSLSCHAGCVADGLLWISGGVTNTAQYQNRLMVYDPSQNKWISRSPMLQRRVYHAMAAV
QRKLYVLGGNDLDYNNDRILVRHIDSYNIDTDQWTRCNFNLLTGQNESGVAVYNGRIYLV
GGYSIWTNEPLACIQVLDVSREGKEEVFYGPTLPFASNGIAASFLPAPYFTCPNLQTLQV
PHHRIGTM
Download sequence
Identical sequences A4IJ04
NP_001016857.2.99540 XP_012818489.1.99540 gi|134025825|gb|AAI36225| gi|134085418|ref|NP_001016857| ENSXETP00000064013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]