SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|138519913|gb|AAI35590| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|138519913|gb|AAI35590|
Domain Number 1 Region: 127-394
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.55e-70
Family Nuclear receptor ligand-binding domain 0.0000098
Further Details:      
 
Domain Number 2 Region: 71-145
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.77e-29
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|138519913|gb|AAI35590|
Sequence length 410
Comment nr2f1 protein [Xenopus (Silurana) tropicalis]
Sequence
MAMVVSSWRDPQEDVAGGNPGGPNPGAREQQQAPSAAPHTPQTPSQPGPPSTPGAAGDKG
QQGSGQSQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQ
HHRNQCQYCRLKKCLKVGMRREVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISLLL
RAEPYPTSRYGSQCMQPNNIMGIENICELAARLLFSAVEWARNIPFFPDLQITDQVALLR
LTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALH
VDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLR
LPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMPIQCS
Download sequence
Identical sequences A4QNF4
NP_001093677.1.99540 gi|138519913|gb|AAI35590| gi|154147672|ref|NP_001093677|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]