SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|147901428|ref|NP_001090732| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147901428|ref|NP_001090732|
Domain Number 1 Region: 514-736
Classification Level Classification E-value
Superfamily GFP-like 6.8e-81
Family Domain G2 of nidogen-1 0.000000766
Further Details:      
 
Domain Number 2 Region: 1252-1508
Classification Level Classification E-value
Superfamily YWTD domain 3.79e-42
Family YWTD domain 0.0000001
Further Details:      
 
Domain Number 3 Region: 1075-1154
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 6.41e-26
Family Thyroglobulin type-1 domain 0.00055
Further Details:      
 
Domain Number 4 Region: 900-995
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 4.19e-24
Family Thyroglobulin type-1 domain 0.00042
Further Details:      
 
Domain Number 5 Region: 998-1072
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.96e-23
Family Thyroglobulin type-1 domain 0.00042
Further Details:      
 
Domain Number 6 Region: 1159-1229
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 7.98e-20
Family Thyroglobulin type-1 domain 0.001
Further Details:      
 
Domain Number 7 Region: 472-511,750-846
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000471
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 8 Region: 838-898
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000121
Family EGF-type module 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|147901428|ref|NP_001090732|
Sequence length 1520
Comment nidogen 2 (osteonidogen) precursor [Xenopus (Silurana) tropicalis]
Sequence
MWDRTLHLLLPLHCLLAFSAAISRHELFPYGELRGDVLLQEGDDETSEVVKLSQPLLFYE
AQFSNLYVGTNGIISTQDFPRETQYVDDGFPTDFPVISPFLSDIDTSNGKGKIFYRQDNS
EQVLNRAVSEIQRGFPETSFVPTDAFLVTWENVGAYEEMTRLSPSSDRRNTFQAVLAYDH
SDAYAIFLYPEDGLQFFGTRPKESYNVHIELPARVGFSRSESGPYYSVTSNEQSVKNLYQ
TGNTGVPGIWVFHIGSIWELDNVIPAKFFGAPTKEQSLENSHTGFPEHRIFEKNESEDSI
DYPESFYEENEDDLEDNTSDATPTHNAHQKVDSDTGNQGYLDIDQASKLTHADVEQEATS
SVVLSSSHQNPDWTPYKLSESDTDRDGPLQEPQVQTGEDTDLTRGDTLLTEELPSHKAHN
LTPQNSEDLSIYPESEVLVGSHPEQENDFERKQIDADPGLQTDVFSFNPVGKETCERNHG
RCSRFAFCADYSAGFCCHCQEDYYGNGVHCLPRGAPHRVNGKVSGNILVGQTPVNFIAAD
LHAYIVANDGRAYTAISHVPDPASWSLTPLAPIGGLFGWLFALEKPGFQNGFSFTGAKFV
HNIDVTFYPGEETVHITQTADGFDSEGYMNVKTAIQGKIPYIPETSTIKLSPYTELYQYS
GSVVTSTAYREYTVISESNEEQKLSYRLRQNVTYQECSHSQKQPVSAQKLYVDRVFALYN
KEEKVLRYAVTNYIGSLHDSTGQDDLTVNPCYDGTHLCDTRAKCQPGSGLEYSCVCASGY
QGDGRDCTDVNECEVGFTRCGQNTVCVNLQGSYRCECASGFTLSGDGHNCILASLINPCE
DGSHTCNRDTSRCVPRGDGVFTCECFPGFNKSGEDCVDVDECTEHRCHPDASCTNTLGSF
SCRCNSGYEGDGFQCTQILGPEPLKTPCLEKRQQLHPRGPRPAVGQFVPECDVEGNYVPL
QCHGSTGHCWCVDKLGEEIAGTRTPPGRPAPNCGETGPEPLKTPCLEKRQQLHPRGPRPA
VGQFVPECDVEGNYVPLQCHGSTGHCWCVDKLGEEIAGTRTPPGRPAPNCGETGPEPLKT
PCLERRQQLLGQLHPRGPRPAVGQFVPECDAEGNYVSLQCHGSTGHCWCVDKLGEEIAGT
RTPPGRPGPNCGETEPTQRPQTVCERWKQSLIEHYGGKPGGEHYVPQCDQYGDFSPLQCH
GNSGYCWCVDKEGREIEGSRTEPGMTPACIPTVAPPTMHPTPRPDVTPPATGTFLLYAQG
QQIGYLPLNGTRLHKEKARTLLSLHGSIVVGIDYDCHEKMVYWTDVAGRTINRASLEPGA
EPETIINTGLMSTEGLAIDYLRRTMFWTDSGLDKIESARLDGTERKVLFDTQLVNPRAIT
VDAVRGNLYWTDWNREAPKIESSFVDGSNRRILVNDNIGLPNGLTFDPFSKQVCWADAGT
KKLECILSDGTGRRVIQSNLNYPFSVVVYANYFYHTDWRRDGVISLNKDTGHIVEEYLPE
QRSHLYGVTAVYPYCPSGRK
Download sequence
Identical sequences A1L1D2
gi|120537348|gb|AAI29004| gi|147901428|ref|NP_001090732| NP_001090732.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]