SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|147903393|ref|NP_001090775| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147903393|ref|NP_001090775|
Domain Number 1 Region: 129-373
Classification Level Classification E-value
Superfamily vWA-like 6.11e-86
Family Integrin A (or I) domain 0.0000000768
Further Details:      
 
Domain Number 2 Region: 372-458
Classification Level Classification E-value
Superfamily Integrin domains 2.3e-23
Family Integrin domains 0.00025
Further Details:      
 
Domain Number 3 Region: 617-695
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.000000000000129
Family Integrin beta tail domain 0.0012
Further Details:      
 
Domain Number 4 Region: 20-78
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000194
Family Plexin repeat 0.0013
Further Details:      
 
Domain Number 5 Region: 574-615
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000026
Family Integrin beta EGF-like domains 0.0017
Further Details:      
 
Domain Number 6 Region: 533-571
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000248
Family Integrin beta EGF-like domains 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|147903393|ref|NP_001090775|
Sequence length 696
Comment integrin, beta 6 [Xenopus (Silurana) tropicalis]
Sequence
MGIELICLFAFILHGKNHVQGSCALGSTMTCGECLKLGPHCAWCSHKNFTDSLDIAVRCD
TYEVLQSKGCPAESIEFPDSKLEVLRNKPLTEGAQENSSDATQISPQKLLLKLRPGRELT
FQIDVRQTENYPVDLYYLMDLSASMEDDLKTIKELGSSLSKEMSKLTNNFQLGFGSFVEK
PVSPFIKTVPKDIENPCHSIPYYCLPTFGYKHVLSLTPNAQNFNEIVKKQWISGNIDTPE
GGFDAIMQAAVCKEQIGWRNGSLHLLVFVSDGDSHYGMDSKLAGIVIPNDGLCHLDSSNE
YYMSTVQEYPSVGQLIEKLVENNILLIFAVTKAYVPLYQGYASLIPGATVGLLAKDSGNV
LQLIINAYKELRSEIELEVLGDTEGLSLSFTALCNNNTAIPHSKKCQHLKVGDRVSFSVS
ITSASCEKHTRHIVIKPVGLEESLEVEIQSECSCQCHREERSSECSKGNGALECGVCVCY
PPYLGDHCQCNEGSLNSSSCKELDSCGGRGECYCGQCICYPSVYGRIYGSHCECDDFSCL
RHRGVICAGHGDCECGECICHSGWSGSYCNCTMDTQTCISENGALCSGRGECVCGKCVCN
NPEVSGDVCERCPTCGDPCSSKRACVECHLLPAEEQQEECEETCKLVDATVSNAEDFSED
KSISCSLQGENECAITFGMATDEHGKKVIYNIQQKK
Download sequence
Identical sequences A4IGI8
gi|134023735|gb|AAI35122| gi|147903393|ref|NP_001090775| NP_001090775.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]