SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|154147594|ref|NP_001093733| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154147594|ref|NP_001093733|
Domain Number 1 Region: 168-270
Classification Level Classification E-value
Superfamily Immunoglobulin 1.6e-20
Family I set domains 0.024
Further Details:      
 
Domain Number 2 Region: 49-135
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000022
Family Growth factor receptor domain 0.0031
Further Details:      
 
Domain Number 3 Region: 121-165
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000388
Family Ovomucoid domain III-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|154147594|ref|NP_001093733|
Sequence length 299
Comment Kazal-type serine peptidase inhibitor domain 1 [Xenopus (Silurana) tropicalis]
Sequence
MFNHAVCISAELLFLLYLSCLQIFPTLSRPSGADYLQRGWQRLLEEGEGCTDCNPEECPL
PRGCLAGVVRDHCDCCLECANLEGQICDLDNTNHFYGKCGDNLECQLDMGDLRHGEVPEP
QCVCVFNTAVCGSDGKTYSQLCKFKEVANAHPGANLTVVHDGPCESAPQILSPPYDIWNI
TGKDAIFGCEVFAYPMASIEWRKDGAEMLLPGDDPHISVQFRGGPQKYEVTGWLQIQSVR
TSDEGTYKCLAKNKIGEVMAGATLTVITPDQLNMTGLSLPKPRDHLFEEDADSEDSDYY
Download sequence
Identical sequences A4II24
8364.ENSXETP00000017639 gi|134025787|gb|AAI35811| gi|154147594|ref|NP_001093733| NP_001093733.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]