SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|154147726|ref|NP_001093752| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154147726|ref|NP_001093752|
Domain Number 1 Region: 108-203
Classification Level Classification E-value
Superfamily Fibronectin type III 6.77e-20
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 2 Region: 199-296
Classification Level Classification E-value
Superfamily Fibronectin type III 8.32e-16
Family Fibronectin type III 0.0000474
Further Details:      
 
Domain Number 3 Region: 36-129
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000233
Family I set domains 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|154147726|ref|NP_001093752|
Sequence length 395
Comment interleukin 11 receptor, alpha precursor [Xenopus (Silurana) tropicalis]
Sequence
MNSLASCLSRVIVLLAVTAVSLSVSSSKWGEEGVLYGKIGGNITLMCNASNDSLVAEWRF
NGTPDISWGFFTDIGHLELPHAHHSATGNYSCYSHSGDLLSSVLLRMGYPPGTPSVFCRA
SDYENFSCFWKSSVETLLPTRFTASYRSRNHMIGVCLQEPVRPNMCSVRKSEFWSSYQMN
ITEENPLGSSFRLLDVTMQSIVKPDPPENLLVEPIPFAPRRLRVSWDYPSTWPKEPHFQL
KFRVQYRPVQHPLWSEVETANLSDIITDAFAGMEHVIQVSAKDFLDAGNWSDWSVEVRAT
PWTREIDITTPTSEETLTDIVEPQIDNPIDVHTDPLEKVAILISLGIFAFVVLALFLIMG
VLIWVRVRKKGMENGMKPDFLSVIHMKALPKVQIL
Download sequence
Identical sequences A4IHR2
NP_001093752.1.99540 gi|134026106|gb|AAI35647| gi|154147726|ref|NP_001093752|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]