SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158254014|gb|AAI54081| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158254014|gb|AAI54081|
Domain Number 1 Region: 451-656
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.29e-37
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 2 Region: 863-1043
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.3e-36
Family Laminin G-like module 0.0026
Further Details:      
 
Domain Number 3 Region: 668-859
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.57e-36
Family Laminin G-like module 0.0083
Further Details:      
 
Domain Number 4 Region: 265-434
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.49e-34
Family Laminin G-like module 0.0022
Further Details:      
 
Domain Number 5 Region: 1076-1216,1245-1287
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-29
Family Laminin G-like module 0.000000436
Further Details:      
 
Domain Number 6 Region: 24-185
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.96e-29
Family Laminin G-like module 0.0051
Further Details:      
 
Weak hits

Sequence:  gi|158254014|gb|AAI54081|
Domain Number - Region: 204-243
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000343
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158254014|gb|AAI54081|
Sequence length 1479
Comment LOC100127647 protein [Xenopus (Silurana) tropicalis]
Sequence
MASVLKQGGLIIWMLLVLGCMVDIGCGLEFPGTESQWTRFPKWNACCESEMSFNMKTKRS
SGLVIYFDDEGFCDFLELILYEGRLKLSFSIFCAEPASLLTDLAVNDNKWHSVVIKRNFK
NTTLILDKESKWVEVKSKRRDMTVFSSLFIGGIPPELHSSTLKLTFPAVKDHSPFQGWIR
DVRVNFSDSSPVTSNDIRMEDEPNPCAQDRVCLNGGICSVVNEEATCDCSQTGFQGKDCS
EEDNRVEGLAHLMMGDQGKTKGKEEYIATFKGSEYFCYDLSQNPIQSSSDEITLSFKTLQ
RNGLMLHTGKSADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFNDNNWHDVKVTRNL
RQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMG
CLKEVVYKNNDVRLELSRLAKQGDAKMKVHGVVAFKCENVATLDPITFETPESFISLPKW
NAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKNPQMIKVDFFAIEMLDGHLYLLLDM
GSGTIKIKAIQKKVNDGEWYHVDFQRDGRTGTISVNTLRTPYTAPGESEILDLDDDLYLG
GLPENKAGLIFPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMAEQQSTAGVKPSCSRET
TKPCINNPCKNNGVCRDGWNRYVCDCSGTGYLGRSCEREATILSYDGSMFMKIQLPVVMH
TEAEDVSLRFRSQRAYGILMATTSRESADTLRLELDAGRVKLTVNLDCIRINCNSSKGPE
TLYAGYNLNDNEWHTVRVIRRGKSLKLTVDDQQGMTGQMAGDHTRLEFHNIETGIITERR
YLSVVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIADPVTFKTKASYV
ALATLQAYTSMHLFFQFKTTSPDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIK
GSSNKPLNDHQWHNVMISRDTSNLHTVKIDTKITTQSTAGARNLDLKSDLYIGGVSKEMY
KTLPKLVHAKEGFQGCLASVDLNGRLPDLISDALLCNGQIERGCEGPSTTCQEDSCANQG
VCLQQWDGFSCDCSMTSFRGPLCNDPGITYIFSKGGGQITYTWPPNDRPSTRADRLAVGF
STVQKEAVLVRVDSSTGLGDYLELHIHQGKIGVKFNVGTDDISIEEVNAIINDGKYHTVR
FTRSGGNATLHVDNWPVIERYPAGNNDNERLAIARQRIPYRLGRVVDDWLLDKGRQLTIF
NSQATIKIGGKDQGQPFQGQLSGLYYNGLKVLNMAAENNPDIVIEGNVRLVGDVPSSMTT
ESTATAMQSEMSTSIMETTTTLATSTRKSPTREPVGQTTDDILVASAECPSDDDEDIDPC
EPSSGGLANPTKANGIPGPSEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEG
SYHVDESRNYISNSAQSNGAVIKEKQPSSAKSSNKKKKK
Download sequence
Identical sequences A8KBE4
gi|158254014|gb|AAI54081|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]