SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158518446|ref|NP_001103517| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158518446|ref|NP_001103517|
Domain Number 1 Region: 158-221
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000023
Family LIM domain 0.062
Further Details:      
 
Domain Number 2 Region: 218-285
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000161
Family LIM domain 0.012
Further Details:      
 
Weak hits

Sequence:  gi|158518446|ref|NP_001103517|
Domain Number - Region: 281-304
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00186
Family LIM domain 0.022
Further Details:      
 
Domain Number - Region: 121-162
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0297
Family LIM domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158518446|ref|NP_001103517|
Sequence length 449
Comment prickle homolog 2 [Xenopus (Silurana) tropicalis]
Sequence
MPLEMEKTMNKLMFDFQRNSTSDDDSGCALEEYAWIPPGLKPEQVHQYYSCLPDDKVPYV
NSPGEKSRIKQLLHQLPPHDNEVRYCNSLDEEEKRELKLFSNQRKRENLGRGNVRPFPVT
MTGAICEQCGGQINGGDMAVFASRAGHGVCWHPQCFVCIICNELLVDLIYFYQDGKIYCG
RHHAECLKPRCAACDEIIFADECTEAEGRHWHMKHFCCFECETVLGGQRYIMKEGRPYCC
NCFESLYAEYCDTCAQHIGIDQGQMTYDGQHWHATENCFCCAHCKKSLLGRPFLPKQGQI
FCSRACSVGEDPNGSDSSDSAFQNARAKESRRSAKIGKNKGKLDDGNMNQCGPLHVASNR
LSADVDPLSLQMDLLSVSSQNPSLNRDQLWRSRDELYHYGNKIERSQSQSPLQLLSQCNI
RTSYTLARGLGPSLICGQNISTTRREACP
Download sequence
Identical sequences A8E4U8
gi|157422814|gb|AAI53336| gi|158518446|ref|NP_001103517|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]