SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|159156023|gb|AAI54910| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|159156023|gb|AAI54910|
Domain Number - Region: 241-271
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000139
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 176-209
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000419
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 209-240
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0028
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 272-304
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00299
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 308-334
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00516
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|159156023|gb|AAI54910|
Sequence length 374
Comment wif1 protein [Xenopus (Silurana) tropicalis]
Sequence
MPLTGCFGAQLCSIFLFVLAHAEAGQQEDSLYMWIDAHQARVLIGFEEDILIVSEGKMAP
FTHDFRKAQQRMPAIPVNIHAMNFTWQATGQAEYFYEFLSLRSLDKGIMADPTVNVPLLG
TVPHKATVVQVGFPCLGNQDGVAAFEVNVIVMNSEGNVILQTPQNAIFFKTCQQAKCPGG
CRNGGFCNDRHVCECPDGFYGPHCEKALCMPRCMNGGLCVTPGLCICPPGYYGINCDKVN
CTTHCLNGGTCFYPGKCICPSGYEGEQCETSKCQQPCRNGGKCSGRNKCKCSKGYQGDLC
SKPVCEPSCGSHGTCIEPNKCQCKEGWNGRYCNKRYGANAMNALRPTGSRNRQHTPSPKR
TEDRQAPPESNYIW
Download sequence
Identical sequences F6RKP1
NP_001106386.1.99540 ENSXETP00000030283 gi|159156023|gb|AAI54910| gi|163915063|ref|NP_001106386| 8364.ENSXETP00000030283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]