SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|160773111|gb|AAI55042| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|160773111|gb|AAI55042|
Domain Number 1 Region: 8-124
Classification Level Classification E-value
Superfamily POZ domain 3.77e-35
Family BTB/POZ domain 0.00081
Further Details:      
 
Domain Number 2 Region: 276-309
Classification Level Classification E-value
Superfamily Kelch motif 0.0000106
Family Kelch motif 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|160773111|gb|AAI55042|
Sequence length 320
Comment LOC100127776 protein [Xenopus (Silurana) tropicalis]
Sequence
MAPKDIMTNSHAKSILNTMNSLRKSQTLCDVTLRVNLKDFPAHRIVLAACSDYFCAMFTN
ELSEKGKPYVDIQGLTSSTMEILLDFVYTETVHVTVENVQELLPAACLLQLKGVKQACCD
FLESQLDPSNCLGIRDFAETHNCLDLMQAAEVYSQKHFPEVVQHEEFMLLHQEEVEKLIH
CDEIQINSEEPVFEAVINWVKHNKNEREKSLPQLLQYVRMPLLTPRYITDVIDAEPLIRC
SLQCRDLVDEAKKFHLRPELRSQMQGPRTRVRLGANEVLLVIGGFGSQQSPIDIVEKYDP
KTQEWSFLPVSVIVAFAMKW
Download sequence
Identical sequences A9JSR2
gi|160773111|gb|AAI55042| gi|163915195|ref|NP_001106569| gi|163916309|gb|AAI57305| NP_001106569.1.99540 ENSXETP00000054929 ENSXETP00000054929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]