SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|163915017|ref|NP_001106379| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163915017|ref|NP_001106379|
Domain Number 1 Region: 729-923
Classification Level Classification E-value
Superfamily Fibronectin type III 1.34e-39
Family Fibronectin type III 0.000036
Further Details:      
 
Domain Number 2 Region: 1021-1117
Classification Level Classification E-value
Superfamily Fibronectin type III 1.38e-23
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 3 Region: 1138-1231
Classification Level Classification E-value
Superfamily Immunoglobulin 3.22e-23
Family I set domains 0.013
Further Details:      
 
Domain Number 4 Region: 644-737
Classification Level Classification E-value
Superfamily Immunoglobulin 8.77e-21
Family I set domains 0.00014
Further Details:      
 
Domain Number 5 Region: 434-526
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000198
Family I set domains 0.0018
Further Details:      
 
Domain Number 6 Region: 158-260
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000753
Family I set domains 0.0000196
Further Details:      
 
Domain Number 7 Region: 358-442
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000917
Family I set domains 0.0000824
Further Details:      
 
Domain Number 8 Region: 9-87
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000012
Family I set domains 0.019
Further Details:      
 
Domain Number 9 Region: 940-1028
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000371
Family I set domains 0.033
Further Details:      
 
Domain Number 10 Region: 535-605
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000465
Family I set domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163915017|ref|NP_001106379|
Sequence length 1233
Comment myosin binding protein C, cardiac [Xenopus (Silurana) tropicalis]
Sequence
MPEPVKKSAFTKKPKSEEVSVGGTVTFAAETDKPGLKVKWQRNNVDITANERFAIKSEGK
QHSLTISNATAEDEVVYAVIAGTSKVKFELKVKEQEKTEEAPAPAPAAPEASEAPAPPAP
DSSAPPPTETAEGEAKPPESAEATAIQPEPPKDEIGLFLERPKDAEITVGSNIKFTARIA
GANLIKKPVVKWFKGKWMDLTSKVGKHLQLHEIYDRNTKIYTFEIQIIQAKTTYAGGYRC
EVSSKDKFDSCNFNLAVHEVSTSGEVDIRAAFRRTGDGAEEAGELDFSALLKKRDNEPKQ
GAEPDVDVWDILKKAPPSEYEKIAFQYGITDLRGLLKRLKKMKKEEKKSEAFLKKMDPAY
QIDKGQKMKLVVEVANPDAEVKWLKNGQEIRVSGSKYIFESIGNKRILTINNCSLADDAA
YQCVIGEEKCFTELFVREPPVQILHSLEDQMVMVGERVEFECEVSEEGAQVKWEKDGVEL
TREETFKYRFKKDGKKHFLIINETTLEDGGNYKVKTNGGESVAELMVQEKQLEVLQDVAD
LTVKAKEQAVFKCEVSDETVTGIWVKNGKEVIPNNRIKITHIGRVHKLTIDDVVPQDEGD
YSFIPNGFAFSLSAKLHFMEVKIDFVPRQEPPKIKLDCMSQCADTIIVVAGNKLRLDVPI
SGDPAPTVVWMKGDKLISEVDGRVHVETHADHCVFIIEGAEKSDEGAYTVLVKNEAGEDK
ANINVKVIEVPDPPESPKISNIGEDFCTVQWDPPKYDGGQPVLGYILERKKKKSYRWMRL
NYDLVKELTYESKRMIEGVVYEMRIYAVNSIGMSLPSQPSQPFMPIAPTSEPTQLVVEDV
SDTSISLKWRPPERIGAGGLDGYTVEYCKEGSTEWVPALQGLTERNSVMIRDLPTGERLT
FRVRAINLAGPSEPCTMKEPVTIREIMQRPKIWLPRYLRQKLIKKVGETVNIVIPFQGKP
RPVVTWLKDGQPVDPKQVGIRNSEADTILFIRKAERDHSGEYKVQIQIENCEDSATICIQ
IVDKPSASQKLKIVEIWGFNVALEWAPPQDDGNTEITGYTVQKADKKTMEWFTVFEHYRR
THCVVSDLIMGNEYYFRVFSENMCGLSEKPCTTKNSAYIQKTGTAYKPPTYKDHEFDEAP
KFTHPLNDRSVVAGYNATLSCAVRGIPKPKITWYKNKMDLSMEARYRSFSKQGVLTLEVR
KPSPFDGGLYTCKAVNEHGVAETECRLEVRVPQ
Download sequence
Identical sequences A9JTS4
gi|160773834|gb|AAI55457| gi|163915017|ref|NP_001106379| NP_001106379.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]