SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|163915761|gb|AAI57614| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163915761|gb|AAI57614|
Domain Number 1 Region: 114-151
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000558
Family Cripto EGF-like domain-like 0.0042
Further Details:      
 
Domain Number 2 Region: 79-109
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000393
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163915761|gb|AAI57614|
Sequence length 183
Comment LOC100135315 protein [Xenopus (Silurana) tropicalis]
Sequence
MTSQLFGFLMFAVIICQAVSLESGCEGSECVKVGVSGKPKQYAEFLNKFNEMNTQTPQRQ
HRNAEAALPFVGLTGVAKQSRTCCKNGGTCILGSFCACPKYFTGRSCEYDERLRDCGVIP
HGEWVQKGCSYCRCGYGLLHCFPHVFSKDCDDSQEVRWHRSGSLRTLSSTIVMFATFILH
RLL
Download sequence
Identical sequences O57517
gi|163915761|gb|AAI57614| gi|166158114|ref|NP_001107465|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]