SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|163915841|gb|AAI57568| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163915841|gb|AAI57568|
Domain Number 1 Region: 101-167
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000141
Family Ovomucoid domain III-like 0.00028
Further Details:      
 
Domain Number 2 Region: 265-319
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000017
Family Ovomucoid domain III-like 0.0061
Further Details:      
 
Domain Number 3 Region: 186-242
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000825
Family Ovomucoid domain III-like 0.0099
Further Details:      
 
Weak hits

Sequence:  gi|163915841|gb|AAI57568|
Domain Number - Region: 28-69
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0149
Family TB module/8-cys domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163915841|gb|AAI57568|
Sequence length 322
Comment LOC100135275 protein [Xenopus (Silurana) tropicalis]
Sequence
MLRMLKRQQLHPGMILLLFWLCYLIEDQKVQAGNCWLQQGKNGRCQVLYMPGMSREECCR
SGRLGTSWTEEDVPNSTLFRWMIFNGGAPNCIPCKETCDNVDCGPGKRCKMNRRSKPRCV
CAPDCSNVTWKGPVCGSDGKTYRDECALLKSKCKGHPDLEVQYQGKCKKTCRDVLCPGSS
TCVVDQTNNAYCVTCNRICPEVMSPDQYLCGNDGIVYASACHLRRATCLLGRSIGVAYEG
KCIKAKSCDDIHCSAGKKCLWDAKMSRGRCAVCAESCPESRSEEAVCASDNTTYPSECAM
KQAACSLGVLLEVKHSGSCNCK
Download sequence
Identical sequences Q9YHV4
ENSDARP00000051064 NP_571112.3.45394 gi|163915841|gb|AAI57568| gi|166158039|ref|NP_001107429|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]