SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|163916003|gb|AAI57156| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163916003|gb|AAI57156|
Domain Number 1 Region: 115-149
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000142
Family Cripto EGF-like domain-like 0.0092
Further Details:      
 
Domain Number 2 Region: 79-110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000328
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163916003|gb|AAI57156|
Sequence length 190
Comment cripto, FRL-1, cryptic family 1 [Xenopus (Silurana) tropicalis]
Sequence
MQLLRFLAILVFSAKYFIKHCKGESCVGLYCNDTGLSLAIKSNTIHQILQDTINATHGKS
PEKSAKTLPFLGITDSKKLNKKCCQNGGTCFLGTFCICPKQFTGRHCEHERRPASCAGVP
HGDWIRQGCLLCRCVSGVLHCFTPESEDCGPVHEKNMRSGVPRTQLSLFIYYLFIANLFY
HIVWHLNIGL
Download sequence
Identical sequences Q0V9F3
NP_001072395.1.99540 gi|111306179|gb|AAI21595| gi|118404164|ref|NP_001072395| gi|163916003|gb|AAI57156|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]