SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|165971495|gb|AAI58245| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|165971495|gb|AAI58245|
Domain Number 1 Region: 193-309
Classification Level Classification E-value
Superfamily EF-hand 3.56e-35
Family Osteonectin 0.01
Further Details:      
 
Domain Number 2 Region: 281-375
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.09e-25
Family Thyroglobulin type-1 domain 0.00084
Further Details:      
 
Domain Number 3 Region: 127-173
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000541
Family Ovomucoid domain III-like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|165971495|gb|AAI58245|
Sequence length 419
Comment LOC100144943 protein [Xenopus (Silurana) tropicalis]
Sequence
MWNPGGSCLILLPLLLPIAWAQGDGKEVENTGNFMEDEQWLSSINQYSGKIKHWNRFRDD
DYIKSWEDNQPGDEALDTTKDPCQKVKCSRHKVCIAHGYQKAMCISRKKLEHRIKQPSMK
IHGNRDSLCKPCHVTQPAAVCGSDGHTYSSVCKLEQQACLSSKQLTVKCQGSCPCPTEHT
PTTTTETGKQGETCTGQDLADLGDRLRDWFQLLHENSKQNNTSNPGSKQVNVLDKSLVAG
CKDSIGWMFSKLDSNNDLFLDQAELAAINLDKYEICIRPFFNSCDTYKDGRVSTAEWCFC
FWREKPPCLVELEKVQIQEAAKRKPGVFIPSCDEDGYYRKMQCDQASGECWCVDQHGSEL
TGTRIHGNPDCDDMVGFSGDFGSGVGWEDEEEKETEDAGEEAEEEEGETGEADDGGYIW
Download sequence
Identical sequences B0BM14
gi|165971495|gb|AAI58245| gi|187607914|ref|NP_001119987| ENSXETP00000013522 ENSXETP00000013522 NP_001119987.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]