SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|165973396|ref|NP_001107159| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|165973396|ref|NP_001107159|
Domain Number 1 Region: 253-370,400-510
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.31e-56
Family Nuclear receptor ligand-binding domain 0.00000137
Further Details:      
 
Domain Number 2 Region: 129-212
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.43e-26
Family Nuclear receptor 0.0000385
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|165973396|ref|NP_001107159|
Sequence length 513
Comment nuclear receptor subfamily 1, group H, member 5 [Xenopus (Silurana) tropicalis]
Sequence
MRQWEDLDQTMANSYVTVSDAYCLAEPLSYYDVLPDHINYQLPDSEFQTASCCQYTNMAY
SPGLQSPSSQCHYTSYGLEAAYGDGQYLLSTCELSKQTTLMTHGVDEVYPTMKRPRVSHA
SIRMKGHEELCVVCGDKASGYHYNALTCEGCKGFFRRSITKNAVYRCKNGGHCEMDMYMR
RKCQECRLKKCKAVGMLAECLLTEVQCKSKRLRKNCKQNNSMLSNVKVEDEGSDSRHVSS
TTKPTKLSSQPELTAEECKLIDHIVTAHQKCGIPLDDLKIFLEESADPEEIFYHFSEAAV
LHVQAFVEFTKRLPGFEMLDHEDQIALLKGSTVEAMLLRSAQIYNLPVMGCSLQTTEGLA
RYPNHSVDFSQIQEFDRCPLYSLEAHSHQDVSTSTADLTEEFITPLFKFFRSMGSLNVTE
AEYALLSAVTVFFSDRPLLQNKPHVEKLQEPLLGILHKYSKLYHPEDPQHFARLIGRLTE
LRTLNHNHSEVLISWKARDTKLTPLLYGFWNLQ
Download sequence
Identical sequences A9ULH5
NP_001107159.1.99540 XP_012808313.1.99540 XP_012808336.1.99540 gi|163916051|gb|AAI57258| gi|165973396|ref|NP_001107159| gi|213627217|gb|AAI70929| gi|213627219|gb|AAI70931| ENSXETP00000046366 ENSXETP00000046366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]