SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166158256|ref|NP_001107311| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166158256|ref|NP_001107311|
Domain Number 1 Region: 37-497
Classification Level Classification E-value
Superfamily Sema domain 1.03e-147
Family Sema domain 0.0000000139
Further Details:      
 
Domain Number 2 Region: 493-546
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000144
Family Plexin repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166158256|ref|NP_001107311|
Sequence length 746
Comment sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4A precursor [Xenopus (Silurana) tropicalis]
Sequence
MPTWKRCWGLLLVLLALLPCLPSDLVPRITFRHGDPGRSLLRFRLENVHNYDQLVLSPDE
TTLYVGARDNILSLGIRPGPIRLLHQAPWPANDSSITSCVNKAKSNKTECFNFIRILAPV
NGSHLYTCGTYAFNPTCTYIELDHFSMPKNPNGTIITMDGRGQSPFDPQHNYTSITIDGE
LYTGTMNNFRGNEPVIFRNLGTKVSLRTEGSHGWLNADAVFVGSFNPQGSSPDSKVYFFF
DETTREYDFFEKMTVARVARVCKNDVGGEKVLQKRWTTFLKAQLTCSLQNHFPFNILHHV
ALQNQPDPNNSVFFGVFRTQWQLGGRRSSAVCLYKLNDIEKVFNGAFKEQNKESSKWNRY
MGVVSDPRPGSCSGGKFSDTDLNFMKEHFLMDEVVLPGAGRPVLVKQNVQYTRIALDSVQ
SVSGLNYTVMFLGTDKGFLHKAVLMGNGSESHIIEEIELLTPEEPVENILLAANEGVLYI
GYSAGVLRVPLANCTVYQSCFDCILARDPYCAWDGASQRCRSVRSEQDKGKSWLQDIERG
NPNTTCFSIGTPRVMRPPSASVKEENYSSCYNTILELRCPHRSALATYSWKTPDLAAPEM
QMVTAEDAQVIIVREDTEGLYECWATESGYRYQVAHYWVRPVSCPGSVAPNTAERDYYKQ
FVVVTVLLVLTLLGCLGLGLYSVRDKLRARSKIQGCSTPETIKLSDSKEKKPLNGLCDTD
GAKPCCVPLGRSTGKMDLENNSVAIS
Download sequence
Identical sequences A9JRL7
gi|161611536|gb|AAI55708| gi|166158256|ref|NP_001107311| NP_001107311.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]