SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166158325|ref|NP_001107521| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166158325|ref|NP_001107521|
Domain Number 1 Region: 2-122
Classification Level Classification E-value
Superfamily Kelch motif 6.28e-22
Family Kelch motif 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|166158325|ref|NP_001107521|
Sequence length 142
Comment kelch domain containing 1 [Xenopus (Silurana) tropicalis]
Sequence
MHDNYLYVWGGYVTIEENEVYLPNDEIWIYDIDSGLWRMHLTDGDLPPSMSGSCGACLNG
KFYVFGGYDDKGYSNQLFCLDLHSKSGQYTWKHINNFKGQSPTARDKLSCWVYDDRKVRF
SGDGTMISMFLTQRHRPGFSPL
Download sequence
Identical sequences A9UMK6
ENSXETP00000060713 NP_001238748.1.99540 gi|163915669|gb|AAI57695| gi|166158325|ref|NP_001107521| gi|354439016|ref|NP_001238748|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]