SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166796606|gb|AAI58971| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166796606|gb|AAI58971|
Domain Number 1 Region: 178-255
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.09e-25
Family Thyroglobulin type-1 domain 0.0002
Further Details:      
 
Domain Number 2 Region: 24-106
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.31e-22
Family Growth factor receptor domain 0.0000532
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166796606|gb|AAI58971|
Sequence length 261
Comment Unknown (protein for MGC:135691) [Xenopus (Silurana) tropicalis]
Sequence
MEMLVPALLLVSLCLGQCQALGSFVHCEPCDDKAMSMCPPTPVGCELVKEPGCGCCMTCA
LAEGHRCGVYTEHCAKGLRCLPEQGEEKPLHALLHGRGVCLNLKNHRDQSKIDSIEEPTT
SETDDLYPSKHRGKMRLTDQKAIALNTFRQKKQSQSRIVSVEKVQSPSTPEHSIEIDMGP
CRRQVETLMQEMKLSHRVYPRAFYLPNCDRKGFFKRKQCKPSRGRKRGLCWCVDKYGLKL
PGIDYVNGDLQCHSFDSSNTE
Download sequence
Identical sequences Q0IJ34
XP_012825854.1.99540 gi|113197707|gb|AAI21209| gi|166796606|gb|AAI58971| gi|170284691|gb|AAI61338| gi|213625623|gb|AAI70988|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]