SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|166796971|gb|AAI59018| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|166796971|gb|AAI59018|
Domain Number 1 Region: 106-136
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000412
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 2 Region: 45-93
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000471
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 
Weak hits

Sequence:  gi|166796971|gb|AAI59018|
Domain Number - Region: 502-546
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000148
Family EGF-type module 0.045
Further Details:      
 
Domain Number - Region: 550-596
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00183
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number - Region: 169-239
Classification Level Classification E-value
Superfamily L-aspartase-like 0.0903
Family L-aspartase/fumarase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|166796971|gb|AAI59018|
Sequence length 598
Comment c9 protein [Xenopus (Silurana) tropicalis]
Sequence
PSAGRMDHIHLILAITTLCAFVSGEPSFSQTPKRLQREVNAPAPIDCQLSSWGSWSRCDP
CTKHRYRSRSIERFGQYGGAPCVNTLGDIQRCIPEEDCMEPPVFCGNDFECESGRCIKAR
LLCNGDNDCGDYSDETCDDKDPKPPCRNMEIELSEIARTAGDGLNILGMKPKRNPFDNEY
FNGICDRVRDGKTYFRKPWNVAALVYKTRADKSFTTETYHDAKSVMSKIIEGLTVNVDAS
LSLKITPTEQKNLTVGASAGLGYSKNKSVQRLRQYSETKDKTYMRVSGTVQLASFQMRTR
GAMLSPTFIEDIKSLPRDYDKAEYFSILEMYGTHYTVSGTVGGKYDLVYVLDSIVMKSLD
ITTEDVTDCLKLNAGANIGGTENGAKVDVNPNVKTDICNKGGGETETEPRRTQKPVIESI
ISFVDGGSVEYVTALEEKLNKKEPVADVDDYIQWASSLKDSPTVINSKSNPIISLIPTDI
KDAYIKTRNLERAIEEYLDEHSVCKCQPCQNGGKVMVIDGECICKCTLHYEGVACQNIKS
DLFSTPKQPIDGGWGCWTISPNCVDGEIIATRKCDNPVPQEGGKPCHGQQTKKIPCEK
Download sequence
Identical sequences B0JZ32
gi|166796971|gb|AAI59018| gi|166796994|gb|AAI59080|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]